IL-6 protein(N-His)(active) (recombinant swine)

IL-6 protein(N-His)(active) (recombinant swine)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSS000005.5 5 µg -

7 - 16 business days*

234.00€
 
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this... more
Product information "IL-6 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this effect is <1.5 ng/mL. Sequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway. The interaction with the membrane- bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. [The UniProt Consortium]
Keywords: IL6, IL-6, Interleukin-6, Recombinant Swine IL-6 protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSS000005

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: swine
MW: 24.78 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-6 protein(N-His)(active) (recombinant swine)"
Write a review
or to review a product.
Viewed