Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
E-PKSS000005.20 | 20 µg | - |
7 - 16 business days* |
588.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this... more
Product information "IL-6 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this effect is <1.5 ng/mL. Sequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway. The interaction with the membrane- bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. [The UniProt Consortium]
Keywords: | IL6, IL-6, Interleukin-6, Recombinant Swine IL-6 protein(N-His)(active) |
Supplier: | Elabscience |
Supplier-Nr: | E-PKSS000005 |
Properties
Application: | Active, Cell culture |
Conjugate: | No |
Host: | E.coli |
Species reactivity: | swine |
MW: | 24.78 kD |
Format: | Lyophilized |
Database Information
KEGG ID : | K05405 | Matching products |
UniProt ID : | P26893 | Matching products |
Gene ID : | GeneID 100628202 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | 4°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed