IL-4 protein(N-His)(active) (recombinant swine)

IL-4 protein(N-His)(active) (recombinant swine)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSS000004.5 5 µg -

7 - 16 business days*

234.00€
 
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect... more
Product information "IL-4 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. [The UniProt Consortium]
Keywords: IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4 protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSS000004

Properties

Application: Active, cell culture
Conjugate: No
Host: E.coli
Species reactivity: swine
MW: 15.85 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-4 protein(N-His)(active) (recombinant swine)"
Write a review
or to review a product.
Viewed