Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used

Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
E-PKSM041471.20 | 20 µg | - |
7 - 16 business days* |
289.00€
|
|||
E-PKSM041471.100 | 100 µg | - |
7 - 16 business days* |
791.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Activity: Measured by its ability to induce CXCL1 secretion in HT-29 cells. The ED50 for this... more
Product information "IL-25 protein(N-His)(active) (recombinant mouse)"
Activity: Measured by its ability to induce CXCL1 secretion in HT-29 cells. The ED50 for this effect is <1 ng/mL Sequence: MYQAVAFLAMIVGTHTVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine produced by various cells such as eosinophils, T- helper type 2 (Th2) cells or epithelial cells that plays a role in internal safety of adaptive immune responses by regulating cytokine production (PubMed:35615348, PubMed:11754819). Promotes and augments T- helper type 2 responses locally or systemically (PubMed:35615348). Exerts its activity via its receptor composed of IL17RA and IL17RB for signal transduction (PubMed:18768888). In turn, stimulates the JAK2- STAT5A pathway and promotes the secretion of type-2 associated cytokines including IL4, IL9 and IL13. Induces also the release of IL8, and IL6 from eosinophils through the combined activation of MAPK and NF-kappa-B pathways. Inhibits the differentiation of T-helper (Th17) cells via the production of IL4, IL5 and IL13. [The UniProt Consortium]
Keywords: | Il25, Il17e, IL-25, IL-17E, Interleukin-25, Interleukin-17E, Recombinant Mouse IL-25 protein(N-His)(active) |
Supplier: | Elabscience |
Supplier-Nr: | E-PKSM041471 |
Properties
Application: | Active, Cell culture |
Conjugate: | No |
Host: | E.coli |
Species reactivity: | mouse |
MW: | 20.04 kD |
Format: | Lyophilized |
Database Information
KEGG ID : | K05493 | Matching products |
UniProt ID : | Q8VHH8 | Matching products |
Gene ID : | GeneID 140806 | Matching products |
Handling & Safety
Storage: | -80°C |
Shipping: | 4°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed