No results were found for the filter!
B7-H3 Stable Cell Line
Item number: ABE-14-521ACL
B7-H3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H3 (also known as CD276). Sequence data: hB7-H3 (accession number NM_001024736) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGT DATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ...
| Application: | FA |
4,103.00€
*
A2AR Stable Cell Line
Item number: ABE-14-522ACL
A2AR Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human adenosine A2A receptor (A2AR, also known as ADORA2A). Sequence data: hA2AR (accession number BC013780) MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYF VVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDR...
| Application: | FA |
4,103.00€
*
ACE2/CHO-K1 Stable Cell Line
Item number: ABE-14-523ACL
ACE2 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal amino...
| Application: | FA |
4,103.00€
*
ACE2/HEK293 Stable Cell Line
Item number: ABE-14-524ACL
ACE2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human angiotensin-converting enzyme 2 (ACE2). ACE2 is a type I transmembrane metalloenzyme located on the outer surface of endothelial cells in the lung, arteries, heart, kidney and intestines. ACE2 cleaves the carboxyl-terminal...
| Application: | FA |
4,103.00€
*
Cas9-Expressing A549 Cell line - High expression
Item number: BPS-78134-H
This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a high-expressing cell line. The expressed Cas9 protein includes a C-terminal...
| Keywords: | SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1, |
| Application: | Knock-out generation, sgRNA screen implementation |
8,560.00€
*
Cas9-Expressing A549 Cell line - Low expression
Item number: BPS-78134-L
This cell line is a clonal derivative from the Cas9-Expressing A549 Cell Pool (BPS-78072). It was generated by limited dilution of the original pool and isolation of individual clones, which were screened based on Cas9 expression to obtain a low-expressing cell line. The expressed Cas9 protein includes a C-terminal...
| Keywords: | SpCas9, SpyCas9, SPy_1046, CRISPR-associated endonuclease Cas9/Csn1, |
| Application: | Knock-out generation, sgRNA screen implementation |
8,560.00€
*
B7-H7 (HHLA2)/TCR Activator CHO Cell Line
Item number: BPS-78321
Recombinant CHO-K1 cells constitutively expressing human B7-H7 (also known as HHLA2: HERV-H LTR-associating protein 2, GenBank accession #NM_007072) and an engineered T cell receptor (TCR) activator. B7-H7 mediates an immune-stimulatory signal via TMIGD2 (Transmembrane and immunoglobulin domain containing 2) in...
| Keywords: | HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2, B7y, B7H7,... |
| Application: | Biological activity characterization, antibody screening |
| Species reactivity: | human |
14,049.00€
*
CD7 CHO Cell Line (Medium or High Expression)-78324-H
Item number: BPS-78324-H
Recombinant CD7 CHO-K1 cell lines expressing full-length human CD7 receptor (accession number: NM_006137.6). Surface expression of human CD7 was confirmed by flow cytometry. Each stable clonal cell line was selected for high or medium levels of CD7 expression to mimic different stages of cancer target cells with...
| Keywords: | CD7, TP41, GP40, T-cell antigen CD7, T-cell leukemia antigen, T-cell surface antigen Leu-9, |
| Application: | Compound screening, immunotherapy research, drug discovery, antibody/ligand characterization |
| Species reactivity: | human |
9,308.00€
*
CD7 CHO Cell Line (Medium or High Expression)-78324-M
Item number: BPS-78324-M
Recombinant CD7 CHO-K1 cell lines expressing full-length human CD7 receptor (accession number: NM_006137.6). Surface expression of human CD7 was confirmed by flow cytometry. Each stable clonal cell line was selected for high or medium levels of CD7 expression to mimic different stages of cancer target cells with...
| Keywords: | CD7, TP41, GP40, T-cell antigen CD7, T-cell leukemia antigen, T-cell surface antigen Leu-9, |
| Application: | Compound screening, immunotherapy research, drug discovery, antibody/ligand characterization |
| Species reactivity: | human |
9,308.00€
*
CALCRL/CRE Luciferase Reporter HEK293 Cell Line
Item number: BPS-78325
Recombinant HEK293 cell line stably expressing full-length human Calcitonin receptor-like receptor (CALCRL/CRLR/CLR, accession number: NM_005795) and containing a firefly luciferase gene under the control of multimerized cAMP response element (CRE). This cell line can be used to measure the EC50 and IC50 of CALCRL...
| Keywords: | Calcitonin gene-related peptide type 1 receptor, CGRP type 1 receptor, Calcitonin receptor-like receptor, CRLR, CGRPR,... |
| Application: | Compound screening, immunotherapy research, drug discovery, antibody/antagonist/ligand characterization |
| Species reactivity: | human |
12,742.00€
*
CD2 CHO Cell Line
Item number: BPS-78330
Recombinant clonal CHO-K1 stable cell line constitutively expressing full length human CD2 protein. The surface expression of CD2 in this cell line was validated by flow cytometry.
| Keywords: | T-cell surface antigen CD2, Erythrocyte receptor, LFA-2, LFA-3 receptor, Rosette receptor, T-cell surface antigen... |
| Application: | Binding assays, antibody screening, cellular context |
| Species reactivity: | human |
9,308.00€
*
CD43 CHO Cell Line
Item number: BPS-78334
Recombinant CHO cell line stably expressing full length human CD43 gene (sialophorin, gpL115, leukosialin, SPN, ref. seq. NM_003123) under the control of the CMV promoter.
| Keywords: | Leukosialin, GPL115, Galactoglycoprotein, GALGP, Leukocyte sialoglycoprotein, Sialophorin, CD_antigen: CD43, LSN, |
| Application: | Antibody screening, CD43 function characterization, cellular context |
| Species reactivity: | human |
9,308.00€
*