Anti-TSG101

Anti-TSG101
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32315 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TSG101, known as Tumor susceptibility gene... more
Product information "Anti-TSG101"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. Protein function: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis, the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413). [The UniProt Consortium]
Keywords: Anti-TSG101, Anti-ESCRT-I complex subunit TSG101, Anti-Tumor susceptibility gene 101 protein, TSG101 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32315

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TSG101"
Write a review
or to review a product.
Anti-TSG101 Anti-TSG101
From 326.00€ *
Anti-TSG101 Anti-TSG101
From 164.00€ *
Anti-TSG101 Anti-TSG101
From 164.00€ *
-30 %
Discount Promotion
Anti-TSG101 Anti-TSG101
624.00€ * 436.80€ *
Viewed