Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32274 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TICAM1 (TIR domain containing adaptor... more
Product information "Anti-TRIF / TICAM1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TICAM1 (TIR domain containing adaptor molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA. Protein function: Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF- kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein- interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively. [The UniProt Consortium]
Keywords: | Anti-Trif, Anti-Ticam1, Anti-TICAM-1, Anti-TIR domain-containing adapter molecule 1, Anti-TIR domain-containing adapter protein inducing IFN-beta, Anti-Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta, TRIF Antibody / |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32274 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | mouse |
Immunogen: | Amino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody. |
Format: | Purified |
Database Information
KEGG ID : | K05842 | Matching products |
UniProt ID : | Q80UF7 | Matching products |
Gene ID : | GeneID 106759 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed