Anti-STING / TMEM173

Anti-STING / TMEM173
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32276 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transmembrane protein 173, also called... more
Product information "Anti-STING / TMEM173"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transmembrane protein 173, also called STING, is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants. Protein function: Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double- stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Essential for the induction of IFN-beta in response to human herpes simplex virus 1 (HHV-1) infection. Exhibits 2',3' phosphodiester linkage-specific ligand recognition. Can bind both 2'-3' linked cGAMP and 3'-3' linked cGAMP but is preferentially activated by 2'-3' linked cGAMP (PubMed:26300263). [The UniProt Consortium]
Keywords: Anti-ERIS, Anti-hMITA, Anti-hSTING, Anti-TMEM173, Anti-Transmembrane protein 173, Anti-Mediator of IRF3 activation, Anti-Stimulator of interferon genes protein, Anti-Endoplasmic reticulum interferon stimulator, STING Antibody / TMEM173
Supplier: NSJ Bioreagents
Supplier-Nr: R32276

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING were used as the immunogen for the STING antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-STING / TMEM173"
Write a review
or to review a product.
Anti-STING (TMEM173) Anti-STING (TMEM173)
From 326.00€ *
Anti-STING/TMEM173 Anti-STING/TMEM173
From 164.00€ *
-30 %
Discount Promotion
Anti-TMEM173 / STING Anti-TMEM173 / STING
520.00€ * 364.00€ *
-30 %
Discount Promotion
Anti-TMEM173 / STING Anti-TMEM173 / STING
624.00€ * 436.80€ *
Viewed