Anti-SMURF2

Anti-SMURF2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32322 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E3 ubiquitin-protein ligase SMURF2 is an... more
Product information "Anti-SMURF2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression Protein function: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level. [The UniProt Consortium]
Keywords: Anti-SMURF2, Anti-hSMURF2, EC=6.3.2.-, Anti-E3 ubiquitin-protein ligase SMURF2, Anti-SMAD ubiquitination regulatory factor 2, Anti-SMAD-specific E3 ubiquitin-protein ligase 2, SMURF2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32322

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SMURF2"
Write a review
or to review a product.
Viewed