Anti-SMC3

Anti-SMC3
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG59225.50 50 µg - -

6 - 14 business days*

30 %
520.00€
364.00€
 
Protein function: Central component of cohesin, a complex required for chromosome cohesion during... more
Product information "Anti-SMC3"
Protein function: Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [The UniProt Consortium]
Keywords: Anti-BAM, Anti-SMC3, Anti-hCAP, Anti-SMC-3, Anti-Bamacan, Anti-SMC protein 3, Anti-Chromosome-associated polypeptide, Anti-Chondroitin sulfate proteoglycan 6, Anti-Structural maintenance of chromosomes protein 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59225

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine, chicken, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH)
MW: 142 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SMC3"
Write a review
or to review a product.
Viewed