Anti-SLC26A4

Anti-SLC26A4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59013.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Sodium-independent transporter of chloride and iodide. [The UniProt Consortium] more
Product information "Anti-SLC26A4"
Protein function: Sodium-independent transporter of chloride and iodide. [The UniProt Consortium]
Keywords: Anti-PDS, Anti-SLC26A4, Anti-Pendrin, Anti-Solute carrier family 26 member 4, Anti-Sodium-independent chloride/iodide transporter
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59013

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ)
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SLC26A4"
Write a review
or to review a product.
Viewed