Anti-SLC22A8

Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

^*1

^*1 Offer expires 16/12/2024

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Discount	Price
ARG40720.50	50 µl		-	-	6 - 14 business days*		30 %	520.00€ 364.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Plays an important role in the excretion/detoxification of endogenous and... more

Close menu

Product information "Anti-SLC22A8"

Protein function: Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone- 3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA). [The UniProt Consortium]

Keywords:	Anti-OAT3, Anti-hOAT3, Anti-SLC22A8, Anti-Organic anion transporter 3, Anti-Solute carrier family 22 member 8
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40720

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, cow, dog, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human SLC22A8. (within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS)
MW:	60 kD
Format:	Affinity Purified