Anti-SLC13A5

Anti-SLC13A5
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40274.50 50 µl - -

6 - 14 business days*

551.00€
 
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into... more
Product information "Anti-SLC13A5"
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic, it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [The UniProt Consortium]
Keywords: Anti-NACT, Anti-NaCT, Anti-SLC13A5, Anti-Na(+)/citrate cotransporter, Anti-Solute carrier family 13 member 5, Anti-Sodium-coupled citrate transporter, Anti-Sodium-dependent citrate transporter
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40274

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF)
MW: 63 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SLC13A5"
Write a review
or to review a product.
Viewed