Anti-SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Prot

Anti-SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Prot
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132954.100 100 µg - -

3 - 19 business days*

744.00€
 
Probable transcription factor.||Applications:|Suitable for use in Western Blot. Other... more
Product information "Anti-SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Prot"
Probable transcription factor. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Anti-Sal-2, Anti-SALL2, Anti-hSal2, Anti-KIAA0360, Anti-Sal-like protein 2, Anti-Zinc finger protein 795, Anti-Zinc finger protein SALL2, Anti-Zinc finger protein Spalt-2
Supplier: United States Biological
Supplier-Nr: 132954

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human SALL2
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Prot"
Write a review
or to review a product.
-15 %
Discount Promotion
Anti-SALL2 Anti-SALL2
164.00€ * From 139.40€ *
Viewed