Anti-RFWD2 (Ring Finger And WD Repeat Domain 2, COP1, FLJ10416, RNF200)

Anti-RFWD2 (Ring Finger And WD Repeat Domain 2, COP1, FLJ10416, RNF200)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
132500.100 100 µg - -

3 - 19 business days*

715.00€
 
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation... more
Product information "Anti-RFWD2 (Ring Finger And WD Repeat Domain 2, COP1, FLJ10416, RNF200)"
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Anti-COP1, Anti-hCOP1, Anti-RFWD2, EC=6.3.2.-, Anti-RING finger protein 200, Anti-E3 ubiquitin-protein ligase RFWD2, Anti-RING finger and WD repeat domain protein 2, Anti-Constitutive photomorphogenesis protein 1 homolog
Supplier: United States Biological
Supplier-Nr: 132500

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 1E4
Conjugate: No
Host: Mouse
Species reactivity: human, mouse
Immunogen: Partial recombinant corresponding to aa632-732 from human RFWD2 (NP_071902) with GST tag. MW of the GST tag alone is 26kD.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RFWD2 (Ring Finger And WD Repeat Domain 2, COP1, FLJ10416, RNF200)"
Write a review
or to review a product.
Viewed