Anti-PYY / Peptide YY

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32451 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Peptide YY (PYY), also known as peptide... more
Product information "Anti-PYY / Peptide YY"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. [The UniProt Consortium]
Keywords: Anti-Pyy, PYY Antibody / Peptide YY
Supplier: NSJ Bioreagents
Supplier-Nr: R32451

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PYY / Peptide YY"
Write a review
or to review a product.
Viewed