Anti-PPARGC1A (Peroxisome Proliferator-activated Receptor gamma Coactivator 1-alpha, PGC-1-alpha, PP

PGC1 beta (peroxisome proliferator-activated receptor gamma coactivator 1 beta), also known as PPARGC1B, is an 110kD protein that belongs to a family of PPAR coactivators. It coactivates nuclear receptors such as ERRalpha, upregulating expression of proteins that promote mitochondrial fusion and control basal mitochondrial biogenesis. N- and C-terminal alternate sequences, or deletion of aa156-194, produce isoforms of 984, 1017, 1023 (most common) and 1055aa. Human PGC1 beta aa315-420, which is common to all isoforms, shares 79% and 76% aa identity with mouse and rat PGC1 beta, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.