Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R31842 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing... more
Product information "Anti-Pokemon / ZBTB7A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger and BTB domain-containing protein 7A, also called Pokemon and FBI-1, is a protein that in humans is encoded by the ZBTB7A gene. It has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors. Protein function: Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1- dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'. [The UniProt Consortium]
Keywords: | Anti-Lrf, Anti-Zbtb7a, Anti-Pokemon, Anti-Leukemia/lymphoma-related factor, Anti-POK erythroid myeloid ontogenic factor, Anti-Zinc finger and BTB domain-containing protein 7A, Anti-POZ and Krueppel erythroid myeloid ontogenic factor, Pokemon Antibody / ZB |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R31842 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | mouse, rat |
Immunogen: | Amino acids DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF of mouse ZBTB7A were used as the immunogen for the ZBTB7A antibody. |
Format: | Purified |
Database Information
KEGG ID : | K10494 | Matching products |
UniProt ID : | O88939 | Matching products |
Gene ID : | GeneID 16969 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed