Anti-PGRMC1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31787 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Progesterone receptor membrane component 1... more
Product information "Anti-PGRMC1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis. Protein function: Receptor for progesterone. [The UniProt Consortium]
Keywords: Anti-mPR, Anti-PGRMC1, Anti-HPR6.6, Anti-Membrane-associated progesterone receptor component 1, PGRMC1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31787

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PGRMC1"
Write a review
or to review a product.
Viewed