Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R31787 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Progesterone receptor membrane component 1... more
Product information "Anti-PGRMC1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis. Protein function: Receptor for progesterone. [The UniProt Consortium]
Keywords: | Anti-mPR, Anti-PGRMC1, Anti-HPR6.6, Anti-Membrane-associated progesterone receptor component 1, PGRMC1 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R31787 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K17278 | Matching products |
UniProt ID : | O00264 | Matching products |
Gene ID : | GeneID 10857 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed