Anti-Peptide YY

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40991.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory... more
Product information "Anti-Peptide YY"
Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. [The UniProt Consortium]
Keywords: Anti-Pyy
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40991

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 29-64 of Mouse Peptide YY (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY)
MW: 11 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Peptide YY"
Write a review
or to review a product.
Viewed