Anti-Pendrin / SLC26A4

Anti-Pendrin / SLC26A4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4263 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pendrin is an anion exchange protein that... more
Product information "Anti-Pendrin / SLC26A4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pendrin is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear, however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph. Protein function: Sodium-independent transporter of chloride and iodide. [The UniProt Consortium]
Keywords: Anti-PDS, Anti-Pendrin, Anti-SLC26A4, Anti-Solute carrier family 26 member 4, Anti-Sodium-independent chloride/iodide transporter, Pendrin Antibody / SLC26A4
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4263

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ were used as the immunogen for the Pendrin antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Pendrin / SLC26A4"
Write a review
or to review a product.
Viewed