Anti-Osteopontin / OPN / SPP1

Anti-Osteopontin / OPN / SPP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31935 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteopontin (OPN), also known as secreted... more
Product information "Anti-Osteopontin / OPN / SPP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. [The UniProt Consortium]
Keywords: Anti-BNSP, Anti-SPP1, Anti-SPP-1, Anti-PSEC0156, Anti-Uropontin, Anti-Osteopontin, Anti-Nephropontin, Anti-Bone sialoprotein 1, Anti-Urinary stone protein, Anti-Secreted phosphoprotein 1, Osteopontin Antibody / OPN / SPP1
Supplier: NSJ Bioreagents
Supplier-Nr: R31935

Properties

Application: WB, ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN of human Osteopontin/SPP1 were used as the immunogen for the SPP1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Osteopontin / OPN / SPP1"
Write a review
or to review a product.
Viewed