Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
%
Discount Promotion
Promotion:
Save 30% on all primary antibodies by Arigo Biolaboratories!
*1
*1 Offer expires 16/12/2024
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Discount | Price |
---|---|---|---|---|---|---|---|---|
ARG40156.50 | 50 µl | - | - |
6 - 14 business days* |
30 %
|
520.00€
364.00€ |
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous... more
Product information "Anti-OPRL1 / Nociceptin Receptor"
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin. [The UniProt Consortium]
Keywords: | Anti-OOR, Anti-OPRL1, Anti-KOR-3, Anti-Nociceptin receptor, Anti-Orphanin FQ receptor, Anti-Kappa-type 3 opioid receptor |
Supplier: | Arigo Biolaboratories |
Supplier-Nr: | ARG40156 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | Synthetic peptide around the C-terminal region of Human OPRL1. (within the following region: ALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKD) |
MW: | 41 kD |
Format: | Affinity Purified |
Database Information
KEGG ID : | K04216 | Matching products |
UniProt ID : | P41146 | Matching products |
Gene ID : | GeneID 4987 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed