Anti-OPRL1 / Nociceptin Receptor

Anti-OPRL1 / Nociceptin Receptor
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG40156.50 50 µl - -

6 - 14 business days*

30 %
520.00€
364.00€
 
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous... more
Product information "Anti-OPRL1 / Nociceptin Receptor"
Protein function: G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin. [The UniProt Consortium]
Keywords: Anti-OOR, Anti-OPRL1, Anti-KOR-3, Anti-Nociceptin receptor, Anti-Orphanin FQ receptor, Anti-Kappa-type 3 opioid receptor
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40156

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide around the C-terminal region of Human OPRL1. (within the following region: ALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKD)
MW: 41 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-OPRL1 / Nociceptin Receptor"
Write a review
or to review a product.
Viewed