Anti-NOXO1

Anti-NOXO1
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG41407.50 50 µl - -

6 - 14 business days*

30 %
520.00€
364.00€
 
Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3... more
Product information "Anti-NOXO1"
Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity. [The UniProt Consortium]
Keywords: Anti-NOXO1, Anti-P41NOX, Anti-Nox organizer 1, Anti-Nox-organizing protein 1, Anti-NADPH oxidase organizer 1, Anti-NADPH oxidase regulatory protein, Anti-SH3 and PX domain-containing protein 5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41407

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: cow, horse)
Immunogen: Synthetic peptide derived from Human NOXO1. (within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR)
MW: 40 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NOXO1"
Write a review
or to review a product.
Viewed