Anti-Neuroserpin

Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

^*1

^*1 Offer expires 16/12/2024

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Discount	Price
ARG59897.50	50 µg		-	-	6 - 14 business days*		30 %	520.00€ 364.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but... more

Close menu

Product information "Anti-Neuroserpin"

Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9442076, PubMed:26329378, PubMed:19265707, PubMed:19285087, PubMed:11880376). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable). [The UniProt Consortium]

Keywords:	Anti-PI12, Anti-PI-12, Anti-SERPINI1, Anti-Serpin I1, Anti-Neuroserpin, Anti-Peptidase inhibitor 12
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59897

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 272-310 of Human Neuroserpin. (KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL)
MW:	46 kD
Format:	Antigen Affinity Purified