Anti-MYF6

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG10823.50	50 µl		-	-	6 - 14 business days*		592.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to... more

Close menu

Product information "Anti-MYF6"

Protein function: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein. [The UniProt Consortium]

Keywords:	Anti-MYF6, Anti-Myf-6, Anti-BHLHC4, Anti-bHLHc4, Anti-Myogenic factor 6, Anti-Muscle-specific regulatory factor 4, Anti-Class C basic helix-loop-helix protein 4
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG10823

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: cow, dog, goat, guinea pig, horse, mouse, rabbit, rat, sheep, zebrafish)
Immunogen:	Synthetic peptide around the N-terminus of Human MYF6.(PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA)
MW:	27 kD
Format:	Affinity Purified