Anti-Monoamine Oxidase B / MAOB

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32040 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO,... more
Product information "Anti-Monoamine Oxidase B / MAOB"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species. Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. [The UniProt Consortium]
Keywords: Anti-MAOB, Anti-MAO-B, EC=1.4.3.4, Anti-Monoamine oxidase type B, Anti-Amine oxidase [flavin-containing] B, Monoamine Oxidase B Antibody / MAOB
Supplier: NSJ Bioreagents
Supplier-Nr: R32040

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Monoamine Oxidase B / MAOB"
Write a review
or to review a product.
Anti-MAOB Anti-MAOB
755.00€ *
-30 %
Discount Promotion
Anti-MAOB Anti-MAOB
624.00€ * 436.80€ *
-30 %
Discount Promotion
Anti-MAOB, Internal Anti-MAOB, Internal
784.00€ * 548.80€ *
Anti-MAOB Anti-MAOB
From 198.00€ *
-30 %
Discount Promotion
Anti-MAOB Anti-MAOB
520.00€ * 364.00€ *
Viewed