Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32040 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO,... more
Product information "Anti-Monoamine Oxidase B / MAOB"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species. Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. [The UniProt Consortium]
Keywords: | Anti-MAOB, Anti-MAO-B, EC=1.4.3.4, Anti-Monoamine oxidase type B, Anti-Amine oxidase [flavin-containing] B, Monoamine Oxidase B Antibody / MAOB |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32040 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody. |
Format: | Purified |
Database Information
KEGG ID : | K00274 | Matching products |
UniProt ID : | P27338 | Matching products |
Gene ID : | GeneID 4129 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
-30 %
Discount Promotion
-30 %
Discount Promotion
-30 %
Discount Promotion
Viewed