Anti-MMP9

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32092 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9, or 92 kDa type... more
Product information "Anti-MMP9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9, or 92 kDa type IV collagenase, is part of a family of proteins involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP9 degrades type IV and V collagens. Protein function: Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. [The UniProt Consortium]
Keywords: Anti-Mmp9, Anti-GELB, Anti-Clg4b, Anti-MMP-9, EC=3.4.24.35, Anti-Gelatinase B, Anti-92 kDa gelatinase, Anti-92 kDa type IV collagenase, Anti-Matrix metalloproteinase-9, MMP9 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32092

Properties

Application: WB, IHC (paraffin), ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF of mouse MMP9 were used as the immunogen for the MMP9 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MMP9"
Write a review
or to review a product.
Viewed