Anti-MAOB

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40379.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has... more

Close menu

Product information "Anti-MAOB"

Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. [The UniProt Consortium]

Keywords:	Anti-MAOB, Anti-MAO-B, EC=1.4.3.4, Anti-Monoamine oxidase type B, Anti-Amine oxidase [flavin-containing] B
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40379

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 448-484 of Human MAOB. (REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER)
MW:	58 kD
Format:	Antigen Affinity Purified