Anti-KCNA3 / Kv1.3

Anti-KCNA3 / Kv1.3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32012 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel,... more
Product information "Anti-KCNA3 / Kv1.3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis. Protein function: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. [The UniProt Consortium]
Keywords: Anti-HGK5, Anti-HLK3, Anti-KCNA3, Anti-HPCN3, Anti-Voltage-gated K(+) channel HuKIII, Anti-Voltage-gated potassium channel subunit Kv1.3, Anti-Potassium voltage-gated channel subfamily A member 3, KCNA3 Antibody / Kv1.3
Supplier: NSJ Bioreagents
Supplier-Nr: R32012

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KCNA3 / Kv1.3"
Write a review
or to review a product.
Viewed