Anti-IDO1 / Indoleamine 2, 3-dioxygenase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31969 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO... more
Product information "Anti-IDO1 / Indoleamine 2, 3-dioxygenase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine. Protein function: Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway (PubMed:17671174). Involved in the peripheral immune tolerance, contributing to maintain homeostasis by preventing autoimmunity or immunopathology that would result from uncontrolled and overreacting immune responses (PubMed:25691885). Tryptophan shortage inhibits T lymphocytes division and accumulation of tryptophan catabolites induces T-cell apoptosis and differentiation of regulatory T-cells (PubMed:25691885). Acts as a suppressor of anti-tumor immunity (PubMed:23103127, PubMed:25157255, PubMed:14502282, PubMed:25691885). Limits the growth of intracellular pathogens by depriving tryptophan (PubMed:25691885). Protects the fetus from maternal immune rejection (PubMed:25691885). [The UniProt Consortium]
Keywords: Anti-IDO, Anti-IDO1, Anti-IDO-1, Anti-Indoleamine 2,3-dioxygenase 1, Anti-Indoleamine-pyrrole 2,3-dioxygenase, IDO1 Antibody / Indoleamine 2, 3-dioxygenase
Supplier: NSJ Bioreagents
Supplier-Nr: R31969

Properties

Application: WB, IHC (paraffin), ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IDO1 / Indoleamine 2, 3-dioxygenase"
Write a review
or to review a product.
Viewed