Anti-HSPA2, clone 4A4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59688.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Molecular chaperone implicated in a wide variety of cellular processes,... more
Product information "Anti-HSPA2, clone 4A4"
Protein function: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release (PubMed:26865365). Plays a role in spermatogenesis. In association with SHCBP1L may participate in the maintenance of spindle integrity during meiosis in male germ cells. [The UniProt Consortium]
Keywords: Anti-HSPA2, Anti-Heat shock 70 kDa protein 2, Anti-Heat shock-related 70 kDa protein 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59688

Properties

Application: IHC (paraffin), WB
Antibody Type: Monoclonal
Clone: 4A4
Conjugate: No
Host: Mouse
Species reactivity: human (Expected: mouse, rat)
Immunogen: Synthetic peptide corresponding to aa. 564-598 of Human HSPA2. (KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK)
MW: 70 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HSPA2, clone 4A4"
Write a review
or to review a product.
Viewed