Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
ARG59688.50 | 50 µg | - | - |
6 - 14 business days* |
551.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Molecular chaperone implicated in a wide variety of cellular processes,... more
Product information "Anti-HSPA2, clone 4A4"
Protein function: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release (PubMed:26865365). Plays a role in spermatogenesis. In association with SHCBP1L may participate in the maintenance of spindle integrity during meiosis in male germ cells. [The UniProt Consortium]
Keywords: | Anti-HSPA2, Anti-Heat shock 70 kDa protein 2, Anti-Heat shock-related 70 kDa protein 2 |
Supplier: | Arigo Biolaboratories |
Supplier-Nr: | ARG59688 |
Properties
Application: | IHC (paraffin), WB |
Antibody Type: | Monoclonal |
Clone: | 4A4 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human (Expected: mouse, rat) |
Immunogen: | Synthetic peptide corresponding to aa. 564-598 of Human HSPA2. (KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK) |
MW: | 70 kD |
Format: | Antigen Affinity Purified |
Database Information
KEGG ID : | K03283 | Matching products |
UniProt ID : | P54652 | Matching products |
Gene ID : | GeneID 3306 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed