Anti-HSD3B2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59756.50 50 µl - -

6 - 14 business days*

551.00€
 
Protein function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of... more
Product information "Anti-HSD3B2"
Protein function: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. [The UniProt Consortium]
Keywords: Anti-HSD3B2, Anti-HSDB3B, EC=5.3.3.1, EC=1.1.1.145, Anti-3-beta-HSD II, Anti-Progesterone reductase, Anti-Steroid Delta-isomerase, Anti-Delta-5-3-ketosteroid isomerase, Anti-3-beta-HSD adrenal and gonadal type
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59756

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, monkey (Expected: mouse, rat, bovine, dog, goat, guinea pig, horse, sheep)
Immunogen: Synthetic peptide around the N-terminal region of Human HSD3B2. (within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN)
MW: 42 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HSD3B2"
Write a review
or to review a product.
Viewed