Anti-HRAS

Anti-HRAS
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31862 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GTPase HRas, also known as transforming... more
Product information "Anti-HRAS"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. Protein function: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. [The UniProt Consortium]
Keywords: Anti-HRAS, Anti-HRAS1, HRAS Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31862

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HRAS"
Write a review
or to review a product.
Viewed