Anti-GSDMD

Anti-GSDMD
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG59248.50 50 µl - -

6 - 14 business days*

30 %
520.00€
364.00€
 
Protein function: Gasdermin-D, N-terminal: Promotes pyroptosis in response to microbial infection... more
Product information "Anti-GSDMD"
Protein function: Gasdermin-D, N-terminal: Promotes pyroptosis in response to microbial infection and danger signals. Produced by the cleavage of gasdermin-D by inflammatory caspases CASP1 or CASP4 in response to canonical, as well as non-canonical (such as cytosolic LPS) inflammasome activators (PubMed:26375003, PubMed:26375259, PubMed:27418190). After cleavage, moves to the plasma membrane where it strongly binds to inner leaflet lipids, including monophosphorylated phosphatidylinositols, such as phosphatidylinositol 4-phosphate, bisphosphorylated phosphatidylinositols, such as phosphatidylinositol (4,5)- bisphosphate, as well as phosphatidylinositol (3,4,5)- bisphosphate, and more weakly to phosphatidic acid and phosphatidylserine (PubMed:27281216). Homooligomerizes within the membrane and forms pores of 10 - 15 nanometers (nm) of inner diameter, possibly allowing the release of mature IL1B and triggering pyroptosis (PubMed:27418190, PubMed:27281216). Exhibits bactericidal activity. Gasdermin-D, N-terminal released from pyroptotic cells into the extracellular milieu rapidly binds to and kills both Gram-negative and Gram-positive bacteria, without harming neighboring mammalian cells, as it does not disrupt the plasma membrane from the outside due to lipid-binding specificity (PubMed:27281216). Under cell culture conditions, also active against intracellular bacteria, such as Listeria monocytogenes. Strongly binds to bacterial and mitochondrial lipids, including cardiolipin. Does not bind to unphosphorylated phosphatidylinositol, phosphatidylethanolamine nor phosphatidylcholine (PubMed:27281216). [The UniProt Consortium]
Keywords: Anti-GSDMD, Anti-FKSG10, Anti-DFNA5L
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59248

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide around the middle region of Human GSDMD. (within the following region: VTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGA)
MW: 53 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GSDMD"
Write a review
or to review a product.
Viewed