Anti-GPR54 / KISS1R

Anti-GPR54 / KISS1R
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4294 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The KiSS1-derived peptide receptor (also... more
Product information "Anti-GPR54 / KISS1R"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds the peptide hormone kisspeptin (metastin). Kisspeptin is involved in the regulation of endocrine function and the onset of puberty, with activation of the kisspeptin receptor triggering release of gonadotropin-releasing hormone (GnRH), and release of kisspeptin itself being inhibited by oestradiol but enhanced by GnRH. Reductions in kisspeptin levels with age may conversely be one of the reasons behind age-related declines in levels of other endocrine hormones such as luteinizing hormone. Protein function: Receptor for metastin (kisspeptin-54 or kp-54), a C- terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein that suppresses metastases in malignant melanomas and in some breast carcinomas without affecting tumorigenicity. The metastasis suppressor properties may be mediated in part by cell cycle arrest and induction of apoptosis in malignant cells. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. The receptor is also probably involved in the regulation and fine- tuning of trophoblast invasion generated by the trophoblast itself. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins. [The UniProt Consortium]
Keywords: Anti-AXOR12, Anti-KISS1R, Anti-KiSS-1R, Anti-hOT7T175, Anti-KiSS-1 receptor, Anti-Metastin receptor, Anti-Hypogonadotropin-1, Anti-Kisspeptins receptor, Anti-G-protein coupled receptor 54, Anti-G-protein coupled receptor OT7T175, GPR54 Antibody / KISS1R
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4294

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK were used as the immunogen for the GPR54 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GPR54 / KISS1R"
Write a review
or to review a product.
Viewed