Anti-FECH

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58616.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Catalyzes the ferrous insertion into protoporphyrin IX. [The UniProt Consortium] more

Close menu

Product information "Anti-FECH"

Protein function: Catalyzes the ferrous insertion into protoporphyrin IX. [The UniProt Consortium]

Keywords:	Anti-FECH, EC=4.99.1.1, Anti-Heme synthase, Anti-Protoheme ferro-lyase, Anti-Ferrochelatase, mitochondrial
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58616

Properties

Application:	ICC, IF, WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: bovine, rat, dog, guinea pig, horse, rabbit, yeast, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human FECH. (within the following sequence: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM)
MW:	47 kD
Format:	Purified