Anti-FABP5 (epidermal)

Anti-FABP5 (epidermal)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4416 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP5, Fatty acid-binding protein,... more
Product information "Anti-FABP5 (epidermal)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Protein function: Intracellular carrier for long-chain fatty acids and related active lipids, such as endocannabinoids, that regulate the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (PubMed:22170058, PubMed:21395585). Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation. May be involved in keratinocyte differentiation (PubMed:8092987). [The UniProt Consortium]
Keywords: Anti-E-FABP, Anti-PA-FABP, Anti-Fatty acid-binding protein 5, Anti-Fatty acid-binding protein, epidermal, Anti-Epidermal-type fatty acid-binding protein, Anti-Psoriasis-associated fatty acid-binding protein homolog, FABP5 Antibody (epidermal)
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4416

Properties

Application: WB, IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FABP5 (epidermal)"
Write a review
or to review a product.
Viewed