Anti-FABP5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58575.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Intracellular carrier for long-chain fatty acids and related active lipids,... more
Product information "Anti-FABP5"
Protein function: Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind (PubMed:8608126, PubMed:12540600). In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, which promotes proliferation and survival (PubMed:17512406). May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling (PubMed:29531087). Modulates inflammation by regulating PTGES induction via NF-kappa- B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (PubMed:29440395). May be involved in keratinocyte differentiation. [The UniProt Consortium]
Keywords: Anti-Fabp5, Anti-Fabpe, Anti-E-FABP, Anti-PA-FABP, Anti-Fatty acid-binding protein 5, Anti-Keratinocyte lipid-binding protein, Anti-Fatty acid-binding protein, epidermal, Anti-Epidermal-type fatty acid-binding protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58575

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD)
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FABP5"
Write a review
or to review a product.
Viewed