Anti-DHODH, clone 4E3.

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6591 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dihydroorotate dehydrogenase (DHODH) is an... more
Product information "Anti-DHODH, clone 4E3."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Protein function: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. Required for UMP biosynthesis via de novo pathway. [The UniProt Consortium]
Keywords: Anti-DHODH, Anti-DHOdehase, Anti-Dihydroorotate oxidase, Anti-Dihydroorotate dehydrogenase (quinone), mitochondrial, DHODH Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6591

Properties

Application: WB, IF, FC
Antibody Type: Monoclonal
Clone: 4E3.
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DHODH, clone 4E3."
Write a review
or to review a product.
Viewed