Anti-DDT

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4562 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDT, D-dopachrome tautomerization,... more
Product information "Anti-DDT"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10. Protein function: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). [The UniProt Consortium]
Keywords: Anti-DDT, EC=4.1.1.84, Anti-D-dopachrome tautomerase, Anti-D-dopachrome decarboxylase, Anti-Phenylpyruvate tautomerase II, DDT Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4562

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DDT"
Write a review
or to review a product.
Viewed