Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4562 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDT, D-dopachrome tautomerization,... more
Product information "Anti-DDT"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10. Protein function: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). [The UniProt Consortium]
Keywords: | Anti-DDT, EC=4.1.1.84, Anti-D-dopachrome tautomerase, Anti-D-dopachrome decarboxylase, Anti-Phenylpyruvate tautomerase II, DDT Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4562 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
Format: | Purified |
Database Information
KEGG ID : | K10028 | Matching products |
UniProt ID : | P30046 | Matching products |
Gene ID : | GeneID 1652 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed