Anti-Cyclin T1 / CCNT1, clone 3B7

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6588 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cyclin-T1 is a protein that in humans is... more
Product information "Anti-Cyclin T1 / CCNT1, clone 3B7"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants. Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which facilitates the transition from abortive to productive elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II) (PubMed:16109376, PubMed:16109377, PubMed:35393539, PubMed:30134174). Required to activate the protein kinase activity of CDK9: acts by mediating formation of liquid-liquid phase separation (LLPS) that enhances binding of P-TEFb to the CTD of RNA Pol II (PubMed:29849146, PubMed:35393539). [The UniProt Consortium]
Keywords: Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1, Cyclin T1 Antibody / CCNT1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6588

Properties

Application: WB, FC
Antibody Type: Monoclonal
Clone: 3B7
Conjugate: No
Host: Mouse
Species reactivity: human, monkey
Immunogen: amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cyclin T1 / CCNT1, clone 3B7"
Write a review
or to review a product.
Viewed