Anti-Cyclin T1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58314.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1)... more
Product information "Anti-Cyclin T1"
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). [The UniProt Consortium]
Keywords: Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58314

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine)
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related Mouse sequence by one amino acid
MW: 81 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cyclin T1"
Write a review
or to review a product.
Viewed