Anti-Cyclin T1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58314.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1)... more

Close menu

Product information "Anti-Cyclin T1"

Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). [The UniProt Consortium]

Keywords:	Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58314

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: bovine)
Immunogen:	Synthetic peptide corresponding to a sequence in the middle region of Human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related Mouse sequence by one amino acid
MW:	81 kD
Format:	Antigen Affinity Purified