Anti-CTRB1

Anti-CTRB1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58550.50 50 µl - -

6 - 14 business days*

551.00€
 
Product information "Anti-CTRB1"
Keywords: EC=3.4.21.1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58550

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, swine, rabbit)
Immunogen: Synthetic peptide around the middle region of Human CTRB1. (within the following sequence: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT)
MW: 28 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CTRB1"
Write a review
or to review a product.
Viewed