Anti-CTRB1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58550.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Close menu

Product information "Anti-CTRB1"

Keywords:	EC=3.4.21.1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58550

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, swine, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human CTRB1. (within the following sequence: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT)
MW:	28 kD
Format:	Affinity Purified