Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32293 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CPT1B is located on 22q13.33. The protein... more
Product information "Anti-CPT1B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
Keywords: | Anti-CPT I, Anti-CPT1B, Anti-CPT1-M, Anti-CPTI-M, Anti-KIAA1670, Anti-Carnitine palmitoyltransferase 1B, Anti-Carnitine palmitoyltransferase I-like protein, Anti-Carnitine O-palmitoyltransferase 1, muscle isoform, Anti-Carnitine O-palmitoyltransferase I, |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32293 |
Properties
Application: | WB, IHC (paraffin), (IF), IF |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B |
Format: | Metabolism |
Database Information
KEGG ID : | K19523 | Matching products |
UniProt ID : | Q92523 | Matching products |
Gene ID : | GeneID 1375 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed